PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G15600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 201aa    MW: 21429 Da    PI: 7.4598
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G15600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.7e-151460148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +WT+eEde l +av+++   +W+ Ia  ++ +R  k+c++rw ++l
  OMERI01G15600.1 14 KTPWTQEEDEALRRAVREHRRQNWAEIALALP-RRGSKSCRLRWCQHL 60
                     579*****************************.***********9986 PP

2Myb_DNA-binding46.96.6e-1568109346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+eEd  +v   + +G++ W+tIar+++ gR+++ +k+rw++
  OMERI01G15600.1  68 AFTAEEDAVIVAQQRVHGNK-WATIARCLP-GRSDNAVKNRWNS 109
                      79******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.806964IPR017930Myb domain
SuperFamilySSF466891.38E-2713107IPR009057Homeodomain-like
SMARTSM007178.6E-151362IPR001005SANT/Myb domain
CDDcd001673.66E-131660No hitNo description
Gene3DG3DSA:1.10.10.601.4E-211667IPR009057Homeodomain-like
PfamPF139219.3E-151774No hitNo description
SMARTSM007171.4E-1165113IPR001005SANT/Myb domain
PROSITE profilePS5129417.14167115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-1968113IPR009057Homeodomain-like
CDDcd001674.44E-968108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAADGGDGSG GGRKTPWTQE EDEALRRAVR EHRRQNWAEI ALALPRRGSK SCRLRWCQHL  60
SPELDSRAFT AEEDAVIVAQ QRVHGNKWAT IARCLPGRSD NAVKNRWNSA LRKLLQVQHA  120
RGAGSPPAAA AAAAAGDGQG DAPVCLQLFP ARAGGVKEAG LFAGEKDVEE EDVATSLTLG  180
LPVLSEAELD LRLGPAWPAT A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141137106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037980.0AP003798.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1005_H01.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649306.11e-108PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-34MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0E0C2H71e-142A0A0E0C2H7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA028769-PA1e-117(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.15e-38myb domain protein 77